<?xml version="1.0" encoding="UTF-8"?>
<emd xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:noNamespaceSchemaLocation="https://ftp.ebi.ac.uk/pub/databases/em_ebi/emdb_related/emdb-schemas/emdb_schemas/v3/v3_0_9_3/emdb.xsd" version="3.0.9.3" emdb_id="EMD-10389">
    <admin>
        <current_status>
            <date>2024-05-22</date>
            <code>REL</code>
            <processing_site>PDBe</processing_site>
        </current_status>
        <sites>
            <deposition>PDBe</deposition>
            <last_processing>PDBe</last_processing>
        </sites>
        <key_dates>
            <deposition>2019-10-21</deposition>
            <header_release>2019-11-06</header_release>
            <map_release>2020-01-15</map_release>
            <update>2024-05-22</update>
        </key_dates>
        <grant_support>
            <grant_reference>
                <funding_body>Wellcome Trust</funding_body>
                <code>202231/Z/16/Z</code>
                <country>United Kingdom</country>
            </grant_reference>
        </grant_support>
        <title>Structure of the RsaA N-terminal domain bound to LPS</title>
        <authors_list>
            <author>von Kuegelgen A</author>
            <author>Bharat TAM</author>
        </authors_list>
        <keywords>S-layer LPS RsaA, STRUCTURAL PROTEIN</keywords>
    </admin>
    <crossreferences>
        <citation_list>
            <primary_citation>
                <journal_citation published="true">
                    <author order="1">von Kugelgen A</author>
                    <author order="2">Tang H</author>
                    <author order="3">Hardy GG</author>
                    <author order="4">Kureisaite-Ciziene D</author>
                    <author order="5">Brun YV</author>
                    <author order="6">Stansfeld PJ</author>
                    <author order="7">Robinson CV</author>
                    <author order="8">Bharat TAM</author>
                    <title>In Situ Structure of an Intact Lipopolysaccharide-Bound Bacterial Surface Layer.</title>
                    <journal_abbreviation>Cell</journal_abbreviation>
                    <volume>180</volume>
                    <first_page>348</first_page>
                    <last_page>358.e15</last_page>
                    <year>2020</year>
                    <external_references type="PUBMED">31883796</external_references>
                    <external_references type="DOI">doi:10.1016/j.cell.2019.12.006</external_references>
                    <external_references type="ISSN">1097-4172</external_references>
                </journal_citation>
            </primary_citation>
        </citation_list>
        <pdb_list>
            <pdb_reference>
                <pdb_id>6t72</pdb_id>
                <relationship>
                    <in_frame>FULLOVERLAP</in_frame>
                </relationship>
            </pdb_reference>
        </pdb_list>
    </crossreferences>
    <sample>
        <name>Structure of RsaA N-terminal domain bound to LPS</name>
        <supramolecule_list>
            <complex_supramolecule supramolecule_id="1">
                <name>Structure of RsaA N-terminal domain bound to LPS</name>
                <parent>0</parent>
                <macromolecule_list>
                    <macromolecule>
                        <macromolecule_id>1</macromolecule_id>
                    </macromolecule>
                </macromolecule_list>
                <details>Structure of RsaA N-terminal domain bound to LPS</details>
                <natural_source database="NCBI">
                    <organism ncbi="190650">Caulobacter vibrioides CB15</organism>
                    <strain>YB1001</strain>
                </natural_source>
                <molecular_weight>
                    <theoretical units="MDa">0.577</theoretical>
                </molecular_weight>
            </complex_supramolecule>
        </supramolecule_list>
        <macromolecule_list>
            <protein_or_peptide macromolecule_id="1">
                <name>S-layer protein</name>
                <natural_source database="NCBI">
                    <organism ncbi="190650">Caulobacter vibrioides CB15</organism>
                </natural_source>
                <molecular_weight>
                    <theoretical units="MDa">0.025820353999999997</theoretical>
                </molecular_weight>
                <details>LPS O-antigen bound to protein</details>
                <number_of_copies>1</number_of_copies>
                <recombinant_expression database="NCBI">
                    <recombinant_organism ncbi="190650">Caulobacter vibrioides CB15</recombinant_organism>
                </recombinant_expression>
                <enantiomer>LEVO</enantiomer>
                <sequence>
                    <string>AYTTAQLVTAYTNANLGKAPDAATTLTLDAYATQTQTGGLSDAAALTNTLKLVNSTTAVAIQTYQFFTGVAPSAAGLDFL
VDSTTNTNDLNDAYYSKFAQENRFINFSINLATGAGAGATAFAAAYTGVSYAQTVATAYDKIIGNAVATAAGVDVAAAVA
FLSRQANIDYLTAFVRANTPFTAAADIDLAVKAALIGTILNAATVSGIGGYATATAAMINDLSDGALSTDNAAGVNLFTA
YPSSGVSGSENLYFQ</string>
                    <external_references type="UNIPROTKB">P35828</external_references>
                </sequence>
            </protein_or_peptide>
            <ligand macromolecule_id="3">
                <name>CALCIUM ION</name>
                <molecular_weight>
                    <theoretical units="MDa">4.0078e-05</theoretical>
                </molecular_weight>
                <number_of_copies>3</number_of_copies>
                <formula>CA</formula>
            </ligand>
        </macromolecule_list>
    </sample>
    <structure_determination_list>
        <structure_determination structure_determination_id="1">
            <method>singleParticle</method>
            <aggregation_state>particle</aggregation_state>
            <specimen_preparation_list>
                <single_particle_preparation preparation_id="1">
                    <concentration units="mg/mL">2.5</concentration>
                    <buffer>
                        <ph>7.5</ph>
                        <component>
                            <concentration units="mM">25.0</concentration>
                            <formula>C8H18N2O4S</formula>
                            <name>HEPES</name>
                        </component>
                        <component>
                            <concentration units="mM">100.0</concentration>
                            <formula>NaCl</formula>
                            <name>sodium chloride</name>
                        </component>
                        <component>
                            <concentration units="mM">1.0</concentration>
                            <formula>MgCl2</formula>
                            <name>magnesium chloride</name>
                        </component>
                        <component>
                            <concentration units="mM">1.0</concentration>
                            <formula>CaCl2</formula>
                            <name>calcium chloride</name>
                        </component>
                        <details>Buffer solutions were prepared fresh from sterile filtered concentrated stocksolutions. Solutions were filtered through a 0.22 um filter to avoid microbial contamination and degassed using a vacuum fold pump.
The pH of the HEPES stock solution was adjusted with sodium hydroxide at 4 deg C.</details>
                    </buffer>
                    <grid>
                        <model>Quantifoil R2/2</model>
                        <material>COPPER/RHODIUM</material>
                        <mesh>200</mesh>
                        <support_film film_type_id="1">
                            <film_material>CARBON</film_material>
                            <film_topology>HOLEY ARRAY</film_topology>
                        </support_film>
                        <pretreatment>
                            <type>GLOW DISCHARGE</type>
                            <time units="s">20</time>
                            <atmosphere>AIR</atmosphere>
                        </pretreatment>
                        <details>20 seconds, 15 mA</details>
                    </grid>
                    <vitrification>
                        <cryogen_name>ETHANE</cryogen_name>
                        <chamber_humidity units="percentage">100</chamber_humidity>
                        <chamber_temperature units="K">283.15</chamber_temperature>
                        <instrument>FEI VITROBOT MARK IV</instrument>
                        <details>Vitrobot options:
Blot time 3 seconds,
Blot force -13,1,
Wait time 10 seconds,
Drain time 0.5 seconds,. </details>
                    </vitrification>
                    <details>RsaA N-terminal domain with LPS</details>
                </single_particle_preparation>
            </specimen_preparation_list>
            <microscopy_list>
                <single_particle_microscopy microscopy_id="1">
                    <microscope>FEI TITAN KRIOS</microscope>
                    <illumination_mode>FLOOD BEAM</illumination_mode>
                    <imaging_mode>BRIGHT FIELD</imaging_mode>
                    <electron_source>FIELD EMISSION GUN</electron_source>
                    <acceleration_voltage units="kV">300</acceleration_voltage>
                    <c2_aperture_diameter units="µm">50.0</c2_aperture_diameter>
                    <nominal_cs units="mm">2.7</nominal_cs>
                    <nominal_defocus_min units="µm">-1.0</nominal_defocus_min>
                    <calibrated_defocus_min units="µm">-1.0</calibrated_defocus_min>
                    <nominal_defocus_max units="µm">-4.0</nominal_defocus_max>
                    <calibrated_defocus_max units="µm">-4.0</calibrated_defocus_max>
                    <nominal_magnification>130000.0</nominal_magnification>
                    <calibrated_magnification>130000.0</calibrated_magnification>
                    <specimen_holder_model>FEI TITAN KRIOS AUTOGRID HOLDER</specimen_holder_model>
                    <cooling_holder_cryogen>NITROGEN</cooling_holder_cryogen>
                    <temperature>
                        <temperature_min units="K">70.0</temperature_min>
                        <temperature_max units="K">70.0</temperature_max>
                    </temperature>
                    <alignment_procedure>
                        <zemlin_tableau/>
                    </alignment_procedure>
                    <specialist_optics>
                        <energy_filter>
                            <name>GIF Quantum LS</name>
                            <slit_width units="eV">20</slit_width>
                        </energy_filter>
                    </specialist_optics>
                    <details>EPU software</details>
                    <image_recording_list>
                        <image_recording image_recording_id="1">
                            <film_or_detector_model>GATAN K2 SUMMIT (4k x 4k)</film_or_detector_model>
                            <detector_mode>COUNTING</detector_mode>
                            <digitization_details>
                                <dimensions>
                                    <width units="pixel">3838</width>
                                    <height units="pixel">3710</height>
                                </dimensions>
                                <frames_per_image>1-20</frames_per_image>
                            </digitization_details>
                            <number_grids_imaged>1</number_grids_imaged>
                            <number_real_images>2422</number_real_images>
                            <average_exposure_time units="s">8.0</average_exposure_time>
                            <average_electron_dose_per_image units="e/Å^2">43.0</average_electron_dose_per_image>
                            <details>Images were collected in movie-mode and subjected to 8 seconds of exposure where a total dose of 43 e-/A2 was applied, and 20 frames were recorded per movie.</details>
                        </image_recording>
                    </image_recording_list>
                </single_particle_microscopy>
            </microscopy_list>
            <singleparticle_processing image_processing_id="1">
                <image_recording_id>1</image_recording_id>
                <details>Movies were motion corrected and dose weighted with MotionCor2 (Zheng et al., 2017) implemented in Relion 3.0 (Zivanov et al., 2018).  Contrast transfer functions (CTFs) of the resulting motion corrected micrographs were estimated using CTFFIND4 (Rohou and Grigorieff, 2015).</details>
                <particle_selection>
                    <number_selected>129633</number_selected>
                    <details>Particles were automatically picked from the motion and CTF corrected micrographs using the AutoPick function in Relion 3.0 (Zivanov et al., 2018).
As particle reference a 3 dimensional reconstruction from an earlier dataset with different pixelsize was used which was reconstructed using an unbiased subtomogram average structure of the same sample.</details>
                </particle_selection>
                <startup_model type_of_model="OTHER">
                    <details>Initial model generation from cryo-ET data was performed using the Relion sub-tomogram averaging pipeline (Bharat et al., 2015; Bharat and Scheres, 2016). An unambiguous 3D reference was generated and used in the single-particle EM pipeline.</details>
                </startup_model>
                <final_reconstruction>
                    <number_classes_used>2</number_classes_used>
                    <applied_symmetry>
                        <point_group>C1</point_group>
                    </applied_symmetry>
                    <algorithm>FOURIER SPACE</algorithm>
                    <resolution units="Å" res_type="BY AUTHOR">3.7</resolution>
                    <resolution_method>FSC 0.143 CUT-OFF</resolution_method>
                    <software_list>
                        <software>
                            <name>RELION</name>
                            <version>3.0</version>
                        </software>
                    </software_list>
                    <details>Particles from two main 3D classes containing 21 or 20 RsaA subunits were combined for a focused 3D auto refinement on the central 14 subunits using the output from the 3D classification as a starting model. The final map was obtained from 115,776 particles and post-processed using a soft mask focused on the inner fourteen subunits.</details>
                    <number_images_used>115776</number_images_used>
                </final_reconstruction>
                <initial_angle_assignment>
                    <type>MAXIMUM LIKELIHOOD</type>
                    <software_list>
                        <software>
                            <name>RELION</name>
                            <version>3.0</version>
                        </software>
                    </software_list>
                    <details>Angle assignment was performed within Relion 3.0.</details>
                </initial_angle_assignment>
                <final_angle_assignment>
                    <type>MAXIMUM LIKELIHOOD</type>
                    <software_list>
                        <software>
                            <name>RELION</name>
                            <version>3.0</version>
                        </software>
                    </software_list>
                    <details>Angle assignment was performed within Relion 3.0.</details>
                </final_angle_assignment>
                <final_three_d_classification>
                    <number_classes>2</number_classes>
                    <average_number_members_per_class>115776.0</average_number_members_per_class>
                    <software_list>
                        <software>
                            <name>RELION</name>
                            <version>3.0</version>
                        </software>
                    </software_list>
                    <details>Particles from two main 3D classes containing 21 or 20 RsaA subunits were combined for a focused 3D auto refinement on the central 14 subunits using the output from the 3D classification as a starting model. The final map was obtained from 115,776 particles and post-processed using a soft mask focused on the inner fourteen subunits.</details>
                </final_three_d_classification>
            </singleparticle_processing>
        </structure_determination>
    </structure_determination_list>
    <map format="CCP4" size_kbytes="108001">
        <file>emd_10389.map.gz</file>
        <symmetry>
            <space_group>1</space_group>
        </symmetry>
        <data_type>IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES)</data_type>
        <dimensions>
            <col>300</col>
            <row>300</row>
            <sec>300</sec>
        </dimensions>
        <origin>
            <col>0</col>
            <row>0</row>
            <sec>0</sec>
        </origin>
        <spacing>
            <x>300</x>
            <y>300</y>
            <z>300</z>
        </spacing>
        <cell>
            <a units="Å">324.0</a>
            <b units="Å">324.0</b>
            <c units="Å">324.0</c>
            <alpha units="deg">90.0</alpha>
            <beta units="deg">90.0</beta>
            <gamma units="deg">90.0</gamma>
        </cell>
        <axis_order>
            <fast>X</fast>
            <medium>Y</medium>
            <slow>Z</slow>
        </axis_order>
        <statistics>
            <minimum>-0.06003098</minimum>
            <maximum>0.107363954</maximum>
            <average>0.000029459738</average>
            <std>0.0039067115</std>
        </statistics>
        <pixel_spacing>
            <x units="Å">1.08</x>
            <y units="Å">1.08</y>
            <z units="Å">1.08</z>
        </pixel_spacing>
        <contour_list>
            <contour primary="true">
                <level>0.0195</level>
                <source>AUTHOR</source>
            </contour>
        </contour_list>
        <label>::::EMDATABANK.org::::EMD-10389::::</label>
        <annotation_details>cryo-EM map of the RsaA protein N-terminal domain</annotation_details>
    </map>
    <interpretation>
        <modelling_list>
            <modelling>
                <refinement_protocol>BACKBONE TRACE</refinement_protocol>
                <details>The carbon backbone of the RsaA protein was manually traced through a single subunit of the cryo-EM density using Coot (Emsley et al., 2010). Initially, side chains were assigned in regions with density corresponding to characteristic aromatic residues allowing us to deduce the register of the amino acid sequence in the map. Side chains for residues 2-243 of RsaA were thus assigned unambiguously and the structure was refined and manually rebuilt using Refmac5 (Murshudov et al., 2011) inside the CCP-EM (Burnley et al., 2017) software suite and Coot.</details>
                <target_criteria>Best fit</target_criteria>
                <refinement_space>RECIPROCAL</refinement_space>
                <overall_bvalue>85.819000000000003</overall_bvalue>
            </modelling>
        </modelling_list>
    </interpretation>
</emd>
